Overview

  • Product name

  • Description

    Rabbit polyclonal to CRMP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat CRMP1 aa 1-250. Expressed in E.coli. N-terminal tags.
    Sequence:

    MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI VPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGG TTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVRE ELEVLVQDKGVNS FQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRIL EMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPV


    Database link: Q14194

  • Positive control

    • IHC-P: Human cerebrum tissue. WB: Human serum; Human lung lysate; Pig, rat and mouse brain lysate; Recombinant human CRMP1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Associated with centrosomes and the mitotic spindle during metaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • Collapsin response mediator protein 1 antibody
    • CRMP 1 antibody
    • CRMP-1 antibody
    • Crmp1 antibody
    • Dihydropyrimidinase like 1 antibody
    • Dihydropyrimidinase related protein 1 antibody
    • Dihydropyrimidinase-related protein 1 antibody
    • DPYL1_HUMAN antibody
    • DPYSL1 antibody
    • DRP 1 antibody
    • DRP-1 antibody
    • DRP1 antibody
    • ULIP-3 antibody
    • Ulip3 antibody
    • Unc-33-like phosphoprotein 3 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for CRMP1 using ab233212 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-CRMP1 antibody (ab233212) at 1 µg/ml

    Lane 1 : Human serum
    Lane 2 : Human lung lysate
    Lane 3 : Pig brain lysate
    Lane 4 : Rat brain lysate
    Lane 5 : Mouse brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-CRMP1 antibody (ab233212) at 1 µg/ml + Recombinant human CRMP1 protein

References

ab233212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up