Overview

  • Product name

  • Description

    Rabbit polyclonal to CRMP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CRMP3 aa 280-560.
    Sequence:

    TASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVT GSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENE FVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKIISAKTHNLNV EYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVY KRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVP PVRNLHQSGFSLSGSQADDHIARRTAQKIMA


    Database link: O14531

  • Positive control

    • IHC-P: Human ovarian cancer and kidney tissues. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration.
  • Sequence similarities

    Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Collapsin response mediator protein 3 antibody
    • CRMP 3 antibody
    • CRMP-3 antibody
    • CRMP3 antibody
    • Dihydropyrimidinase like 4 antibody
    • Dihydropyrimidinase related protein 4 antibody
    • Dihydropyrimidinase-related protein 4 antibody
    • DPYL4_HUMAN antibody
    • DPYSL4 antibody
    • DRP 4 antibody
    • DRP-4 antibody
    • DRP4 antibody
    • ULIP 4 antibody
    • ULIP-4 antibody
    • ULIP4 antibody
    • UNC33 like phosphoprotein 4 antibody
    • UNC33-like phosphoprotein 4 antibody
    see all

Images

  • Paraffin-embedded human ovarian cancer tissue stained for CRIMP3 using ab234749 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for CRIMP3 using ab234749 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells labelling CRMP3 (green) using ab234749 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab234749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up