Overview

  • Product name

  • Description

    Rabbit polyclonal to CROP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CROP aa 1-247. Expressed in E.coli.
    Sequence:

    MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTN TRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRI RRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEG KVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLI VGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRDERL


    Database link: O95232

  • Positive control

    • WB: Recombinant human CROP; mouse and pig cerebrum tissue lysate; HeLa whole cell lysate. IHC-P: Human liver and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 51 kDa.

Target

  • Function

    Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.
  • Tissue specificity

    Widely expressed. Highest levels in heart, brain, pancreas, thymus, ovary, small intestine and peripheral blood leukocytes, as well as cerebellum, putamen and pituitary gland. Lowest levels in lung, liver and kidney. Also expressed in fetal tissues, including brain, heart, kidney, thymus and lung.
  • Sequence similarities

    Belongs to the Luc7 family.
  • Post-translational
    modifications

    Phosphorylated in vitro by SRPK1, SRPK2 and CLK1.
  • Cellular localization

    Nucleus speckle. The subnuclear localization is affected by cisplatin.
  • Information by UniProt
  • Database links

  • Alternative names

    • cAMP regulatory element-associated protein 1 antibody
    • Cisplatin resistance-associated overexpressed protein antibody
    • Cisplatin resistance-associated-overexpressed protein antibody
    • CRA antibody
    • CRE-associated protein 1 antibody
    • CREAP-1 antibody
    • CREAP1 antibody
    • CROP antibody
    • hLuc7A antibody
    • LC7L3_HUMAN antibody
    • LUC7 like 3 pre mRNA splicing factor antibody
    • Luc7-like protein 3 antibody
    • Luc7A antibody
    • LUC7L3 antibody
    • O48 antibody
    • OA48 18 antibody
    • Okadaic acid-inducible phosphoprotein OA48-18 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CROP using ab231982 at 20 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CROP using ab231982 at 20 μg/ml in immunohistochemical analysis.

  • Anti-CROP antibody (ab231982) at 2 µg/ml + Recombinant human CROP protein

    Developed using the ECL technique.

    Predicted band size: 51 kDa

  • Anti-CROP antibody (ab231982) at 2 µg/ml + Mouse cerebrum tissue lysate

    Developed using the ECL technique.

    Predicted band size: 51 kDa

  • Anti-CROP antibody (ab231982) at 2 µg/ml + Pig cerebrum tissue lysate

    Developed using the ECL technique.

    Predicted band size: 51 kDa

  • Anti-CROP antibody (ab231982) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 51 kDa

References

ab231982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up