Overview

  • Product name

  • Description

    Rabbit polyclonal to CRTAM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human CRTAM aa 40-90 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVT L


    Database link: O95727

  • Positive control

    • A549 cell lysate; Mouse lymphoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/1000. Predicted molecular weight: 45 kDa.

Target

  • Function

    Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo.
  • Tissue specificity

    In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 cells. Strongly expressed in spleen, thymus, small intestine, peripheral blood leukocyte, and in Purkinje neurons in cerebellum. Expressed at much lower levels in testis, ovary, colon, lung and lymphoid tissues.
  • Sequence similarities

    Belongs to the nectin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD355 antibody
    • Class I MHC restricted T cell associated molecule antibody
    • Class-I MHC-restricted T-cell-associated molecule antibody
    • CRTAM antibody
    • CRTAM_HUMAN antibody
    • Cytotoxic and regulatory T cell molecule antibody
    • Cytotoxic and regulatory T-cell molecule antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse lymphoma tissue labeling CRTAM with ab214306 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

  • Anti-CRTAM antibody (ab214306) at 1/300 dilution + A549 cell lysate

    Predicted band size: 45 kDa

References

ab214306 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214306.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up