Overview

  • Product name

  • Description

    Rabbit polyclonal to CRTAP/CASP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human CRTAP/CASP aa 20-240 (internal sequence).
    Sequence:

    LRAGRAQYERYSFRSFPRDELMPLESAYRHALDKYSGEHWAESVGYLEIS LRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLK RCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHT FLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGE NWRTSITDMELALPDFFKAF


    Database link: O75718

  • Positive control

    • WB: HEK-293T and HeLa whole cell lysates. IHC-P: Human colon cancer tissue and human kidney tissue.
  • General notes

     This product was previously labelled as CRTAP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab229871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).

Target

  • Relevance

    CRTAP/CASP is found in articular chondrocytes and is expressed in a variety of other tissues. Defects in CRTAP/CASP are the cause of osteogenesis imperfecta type 7 (OI-7). OI is a connective tissue disorder characterized by bone fragility and low bone mass. OI-7 is an autosomal recessive form of OI.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Cartilage associated protein antibody
    • CASP antibody
    • Leprecan like 3 antibody
    • LEPREL3 antibody
    • OI7 antibody
    see all

Images

  • All lanes : Anti-CRTAP/CASP antibody (ab229871) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 47 kDa

  • Paraffin-embedded human kidney tissue stained for CRTAP/CASP using ab229871 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissuse stained for CRTAP/CASP using ab229871 at 1/100 dilution in immunohistochemical analysis.

References

ab229871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up