Overview

  • Product name

  • Description

    Rabbit polyclonal to CRTC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CRTC3 aa 491-556.
    Sequence:

    SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSN CGSLPNTILPEDSSTS


    Database link: Q6UUV7

  • Positive control

    • SiHa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).
  • Tissue specificity

    Predominantly expressed in B and T lymphocytes. Highest levels in lung. Also expressed in brain, colon, heart, kidney, ovary, and prostate. Weak expression in liver, pancreas, muscle, small intestine, spleen and stomach.
  • Sequence similarities

    Belongs to the TORC family.
  • Cellular localization

    Nucleus. Cytoplasm. Appears to be mainly nuclear.
  • Information by UniProt
  • Database links

  • Alternative names

    • CREB regulated transcription coactivator 3 antibody
    • CREB-regulated transcription coactivator 3 antibody
    • CRTC 3 antibody
    • CRTC3 antibody
    • CRTC3_HUMAN antibody
    • FLJ21868 antibody
    • TORC 3 antibody
    • TORC-3 antibody
    • TORC3 antibody
    • Transducer of CREB protein 3 antibody
    • Transducer of regulated cAMP response element binding protein (CREB) 3 antibody
    • Transducer of regulated cAMP response element binding protein 3 antibody
    • Transducer of regulated cAMP response element-binding protein 3 antibody
    • Transducer of regulated CREB protein 3 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SiHa cells labeling CRTC3 with ab221109 at 4 µg/ml (green).

References

ab221109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up