Overview

  • Product name

  • Description

    Rabbit polyclonal to CRYL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CRYL1 aa 24-232. Expressed in E. coli. N-terminal His-tag and S-tag.
    Sequence:

    LFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLS LISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSST SCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTH ALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLV MSEGLGMRY


    Database link: Q9Y2S2-1

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human CRYL1 protein; Mouse kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Relevance

    CRYL1 is involved in the uronate cycle which functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. CRYL1 catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • CRY antibody
    • CRYL 1 antibody
    • Crystallin lambda 1 antibody
    • GDH antibody
    • Gul3DH antibody
    • L gulonate 3 dehydrogenase antibody
    • Lambda CRY antibody
    • Lambda crystallin homolog antibody
    • MGC149525 antibody
    • MGC149526 antibody
    see all

Images

  • Anti-CRYL1 antibody (ab231257) at 2 µg/ml + Mouse kidney lysate
  • Anti-CRYL1 antibody (ab231257) at 2 µg/ml + Recombinant human CRYL1 protein
  • Formalin-fixed, paraffin-embedded human liver tissue stained for CRYL1 using ab231257 at 20 µg/mL in immunohistochemical analysis.

References

ab231257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up