Overview

  • Product name

  • Description

    Rabbit polyclonal to CRYL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CRYL1 aa 42-127.
    Sequence:

    IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHI QECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM


    Database link: Q9Y2S2

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab247018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    CRYL1 is involved in the uronate cycle which functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. CRYL1 catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • CRY antibody
    • CRYL 1 antibody
    • Crystallin lambda 1 antibody
    • GDH antibody
    • Gul3DH antibody
    • L gulonate 3 dehydrogenase antibody
    • Lambda CRY antibody
    • Lambda crystallin homolog antibody
    • MGC149525 antibody
    • MGC149526 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling CRYL1 using ab247018 at 4 µg/ml (green) in ICC/IF.

  • Paraffin-embedded human kidney tissue stained for CRYL1 using ab247018 at 1/1000 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal muscle tissue stained for CRYL1 using ab247018 at 1/1000 dilution in immunohistochemical analysis. Low expression as expected.

References

ab247018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab247018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up