Overview

  • Product name

    Anti-CRYZL1 antibody
  • Description

    Rabbit polyclonal to CRYZL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CRYZL1 aa 1-72.
    Sequence:

    MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLL AEMKMKKDLFPVGREIAGIVLD


    Database link: O95825

  • Positive control

    • WB: HEK-293T cells overexpressing recombinant CRYZL1 with C-terminal myc-DDK tag, cell lysate. IHC-P: Human rectum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 39 kDa.

Target

  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4P11 antibody
    • Crystallin zeta (quinone reductase) like 1 antibody
    • CRYZL1 antibody
    • Protein 4P11 antibody
    • QOH 1 antibody
    • QOH-1 antibody
    • QOH1 antibody
    • QORL1_HUMAN antibody
    • Quinone oxidoreductase homolog 1 antibody
    • Quinone oxidoreductase like 1 antibody
    • Quinone oxidoreductase-like protein 1 antibody
    • Quinone reductase like 1 antibody
    • Zeta crystallin homolog antibody
    • Zeta-crystallin homolog antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for CRYZL1 with ab224414 (1/20) in immunohistochemical analysis.

  • All lanes : Anti-CRYZL1 antibody (ab224414) at 1/100 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with vector only, cell lysate
    Lane 2 : HEK-293T cells transfected with recombinant CRYZL1 with C-terminal myc-DDK tag (~3.1 kDa), cell lysate

    Predicted band size: 39 kDa

References

ab224414 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up