Overview

  • Product name
  • Description
    Rabbit polyclonal to CSDE1/NRU
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human CSDE1/NRU aa 50-100. The exact sequence is proprietary. (NP_001007554.1).
    Sequence:

    FFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEER M


    Database link: O75534

  • Positive control
    • HeLa and 293T whole cell lysates.
  • General notes

     This product was previously labelled as CSDE1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab176584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 89 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.
  • Sequence similarities
    Contains 9 CSD (cold-shock) domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cold shock domain containing E1 RNA binding antibody
    • Cold shock domain containing protein E1 antibody
    • Cold shock domain-containing protein E1 antibody
    • Csde1 antibody
    • CSDE1_HUMAN antibody
    • D1S155E antibody
    • DKFZp779B0247 antibody
    • DKFZp779J1455 antibody
    • FLJ26882 antibody
    • N-ras upstream gene protein antibody
    • NRAS related antibody
    • Nras upstream gene protein antibody
    • NRU antibody
    • Protein UNR antibody
    • RP5 1000E10.3 antibody
    • UNR antibody
    • UNR protein antibody
    • Upstream of NRAS antibody
    see all

Images

  • Detection of CSDE1/NRU by Western Blot of Immunprecipitate.
    ab176584 at 0.4µg/ml labeling CSDE1/NRU in HeLa whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176584 at 6µg/mg lysate.

    Detection: Chemiluminescence with exposure time of 10 seconds.

  • All lanes : Anti-CSDE1/NRU antibody (ab176584) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 89 kDa


    Exposure time: 10 seconds

References

This product has been referenced in:
  • Ju Lee H  et al. A post-transcriptional program coordinated by CSDE1 prevents intrinsic neural differentiation of human embryonic stem cells. Nat Commun 8:1456 (2017). Read more (PubMed: 29129916) »
  • Phillips SL  et al. Identification of Proteins Bound to Dengue Viral RNA In Vivo Reveals New Host Proteins Important for Virus Replication. MBio 7:e01865-15 (2016). Read more (PubMed: 26733069) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up