Overview

  • Product name

  • Description

    Rabbit polyclonal to CSDE1/NRU
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CSDE1/NRU aa 418-554.
    Sequence:

    VSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVK LTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSK RLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVD


    Database link: O75534

  • Positive control

    • IHC-P: Human kidney, placenta, testis, endometrial, and prostate tissue; ICC/IF: MCF7 cells.
  • General notes

     This product was previously labelled as CSDE1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.
  • Sequence similarities

    Contains 9 CSD (cold-shock) domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cold shock domain containing E1 RNA binding antibody
    • Cold shock domain containing protein E1 antibody
    • Cold shock domain-containing protein E1 antibody
    • Csde1 antibody
    • CSDE1_HUMAN antibody
    • D1S155E antibody
    • DKFZp779B0247 antibody
    • DKFZp779J1455 antibody
    • FLJ26882 antibody
    • N-ras upstream gene protein antibody
    • NRAS related antibody
    • Nras upstream gene protein antibody
    • NRU antibody
    • Protein UNR antibody
    • RP5 1000E10.3 antibody
    • UNR antibody
    • UNR protein antibody
    • Upstream of NRAS antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling CSDE1/NRU with ab204177 at 1/50 dilution.

  • Immunofluorescent analysis of MCF7 cells (PFA-fixed/Triton X-100 permeabilized) labeling CSDE1/NRU with ab204177 at 4 µg/ml (green).

  • Immunohistochemical analysis of paraffin-embedded Human prostate tissue labeling CSDE1/NRU with ab204177 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling CSDE1/NRU with ab204177 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling CSDE1/NRU with ab204177 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human endometrium tissue labeling CSDE1/NRU with ab204177 at 1/50 dilution.

References

ab204177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up