Overview

  • Product name

  • Description

    Rabbit polyclonal to CSN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Xenopus laevis, Drosophila melanogaster, Zebrafish
  • Immunogen

    Recombinant fragment corresponding to Human CSN2 aa 225-312.
    Sequence:

    KSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRT TCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMT


    Database link: P61201

  • Positive control

    • IHC: Human stomach tissue. WB: HEK-293T overexpressing CSN2 cell lysate.
  • General notes

     This product was previously labelled as TRIP15

     

Properties

Applications

Our Abpromise guarantee covers the use of ab223764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 52 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.
  • Sequence similarities

    Belongs to the CSN2 family.
    Contains 1 PCI domain.
  • Post-translational
    modifications

    Phosphorylated by CK2 and PKD kinases.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

    see all
  • Alternative names

    • ALIEN antibody
    • Alien Drosophila himolog of antibody
    • Alien homolog antibody
    • COP 9 antibody
    • COP9 antibody
    • COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) antibody
    • COP9 constitutive photomorphogenic homolog subunit 2 antibody
    • COP9 signalosome complex subunit 2 antibody
    • COPS 2 antibody
    • Cops2 antibody
    • CSN2 antibody
    • CSN2_HUMAN antibody
    • JAB1 containing signalosome subunit 2 antibody
    • JAB1-containing signalosome subunit 2 antibody
    • SGN 2 antibody
    • SGN2 antibody
    • Signalosome subunit 2 antibody
    • Thyroid Hormone Receptor Interactor15 antibody
    • Thyroid Hormone Receptor Interactor 15 antibody
    • Thyroid receptor-interacting protein 15 antibody
    • TR-interacting protein 15 antibody
    • TRIP 15 antibody
    • TRIP-15 antibody
    • TRIP15 antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for CSN2 using ab223764 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-CSN2 antibody (ab223764) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) overexpressing CSN2 (co-expressed with a C-terminal myc-DDK tag), cell lysate

    Developed using the ECL technique.

    Predicted band size: 52 kDa

References

ab223764 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223764.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up