Overview

  • Product name

    Anti-CSN5 antibody
  • Description

    Rabbit polyclonal to CSN5
  • Host species

    Rabbit
  • Specificity

    Recognizes Arabidopsis and cauliflower COP9 signalosome (CSN5 subunit).
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Arabidopsis thaliana, Plants
  • Immunogen

    This product was produced with the following immunogens:
    Recombinant full length protein corresponding to Arabidopsis thaliana CSN5 aa 1-358. CSN5A.
    Sequence:

    MEGSSSTIARKTWELENSILTVDSPDSTSDNIFYYDDTSQTRFQQEKPWE NDPHYFKRVK ISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMD AFALPVEGTETRVNAQDDAYEY MVEYSQTNKLAGRLENVVGWYHSHPG YGCWLSGIDVSTQRLNQQHQEPFLAVVIDPTRTV SAGKVEIGAFRTYS KGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSH LL DLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGV VPSSLHKK KEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSMRQ SNNKSPTDSSDPDPMITY


    Database link: Q9FVU9

    Recombinant full length protein corresponding to Arabidopsis thaliana CSN5 aa 1-357. CSN5B.
    Sequence: MEGSSSAIARKTWELENNILPVEPTDSASDSIFHYDDASQAKIQQEKPWA SDPNYFKRVH ISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMD AFALPVEGTETRVNAQSDAYEY MVEYSQTSKLAGRLENVVGWYHSHPG YGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTV SAGKVEIGAFRTYP EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSH LL DLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGGI APAGHQRR KEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQ SKKSADDSSDPEPMITS
    Database link: Q8LAZ7

Properties

Applications

Our Abpromise guarantee covers the use of ab195635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 40, 39 kDa.

Target

  • Relevance

    CSN5 is a subunit of the JUN activation-domain binding protein 1 (JAB1), containing signalosome complex (or COP9 complex) which has kinase activity and phosphorylates C-JUN. The signalosome complex may play a role in signal transduction.
  • Cellular localization

    Cytoplasmic and Nuclear
  • Database links

    • Alternative names

      • 38 kDa Mov34 homolog antibody
      • 38 kDa MOV34 isologue antibody
      • COP9 (constitutive photomorphogenic) homolog subunit 5 antibody
      • COP9 (constitutive photomorphogenic) subunit 5 antibody
      • COP9 (constitutive photomorphogenic) subunit 5 antibody
      • COP9 complex homolog subunit 5 antibody
      • COP9 constitutive photomorphogenic homolog subunit 5 antibody
      • COP9 signalosome complex subunit 5 antibody
      • COP9 signalosome subunit 5 antibody
      • COPS5 antibody
      • CSN complex subunit 5 antibody
      • CSN5 antibody
      • CSN5 SCHPO antibody
      • CSN5 SCHPO antibody
      • JAB1 antibody
      • Jun Activating Domain Binding Protein antibody
      • JUN activation binding protein antibody
      • Jun coactivator antibody
      • KIC2 antibody
      • Mov34 antibody
      • SGN5 antibody
      see all

    References

    ab195635 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab195635.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up