Anti-CSN7A antibody (ab235400)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CSN7A antibody
See all CSN7A primary antibodies -
Description
Rabbit polyclonal to CSN7A -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Orangutan
-
Immunogen
Recombinant full length protein corresponding to Human CSN7A aa 2-275.
Sequence:SAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPN VRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSV VTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQR LEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQ QLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQ RQPSKKASKGKGLRGSAKIWSKSN
Database link: Q9UBW8 -
Positive control
- WB: Mouse brain lysate. IHC-P: Human adrenal gland and placenta tissues.
-
General notes
This product was previously labelled as COPS7A
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235400 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/5000. Predicted molecular weight: 30 kDa. | |
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. -
Tissue specificity
Widely expressed. Expressed at high level in brain, heart and skeletal muscle. -
Sequence similarities
Belongs to the CSN7/EIF3M family. CSN7 subfamily.
Contains 1 PCI domain. -
Post-translational
modificationsPhosphorylated by CK2 and PKD kinases. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 50813 Human
- Entrez Gene: 26894 Mouse
- Entrez Gene: 100173397 Orangutan
- SwissProt: Q9UBW8 Human
- SwissProt: Q9CZ04 Mouse
- SwissProt: Q5R762 Orangutan
- Unigene: 530823 Human
- Unigene: 244536 Mouse
-
Alternative names
- COP9 complex subunit 7a antibody
- COP9 constitutive photomorphogenic homolog subunit 7A antibody
- COP9 signalosome complex subunit 7a antibody
see all
Images
-
Western blot - Anti-CSN7A antibody (ab235400)Anti-CSN7A antibody (ab235400) at 1/1000 dilution + Mouse brain tissue lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 30 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CSN7A antibody (ab235400)Paraffin-embedded human adrenal gland tissue stained for CSN7A using ab235400 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CSN7A antibody (ab235400)Paraffin-embedded human placenta tissue stained for CSN7A using ab235400 at 1/100 dilution in immunohistochemical analysis.
References
ab235400 has not yet been referenced specifically in any publications.
