Anti-CSN7A antibody (ab235400)
Key features and details
- Rabbit polyclonal to CSN7A
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-CSN7A antibody
See all CSN7A primary antibodies -
Description
Rabbit polyclonal to CSN7A -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Orangutan -
Immunogen
Recombinant full length protein corresponding to Human CSN7A aa 2-275.
Sequence:SAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPN VRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSV VTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQR LEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQ QLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQ RQPSKKASKGKGLRGSAKIWSKSN
Database link: Q9UBW8 -
Positive control
- WB: Mouse brain lysate. IHC-P: Human adrenal gland and placenta tissues.
-
General notes
This product was previously labelled as COPS7A
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235400 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Predicted molecular weight: 30 kDa. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. -
Tissue specificity
Widely expressed. Expressed at high level in brain, heart and skeletal muscle. -
Sequence similarities
Belongs to the CSN7/EIF3M family. CSN7 subfamily.
Contains 1 PCI domain. -
Post-translational
modificationsPhosphorylated by CK2 and PKD kinases. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 50813 Human
- Entrez Gene: 26894 Mouse
- Entrez Gene: 100173397 Orangutan
- SwissProt: Q9UBW8 Human
- SwissProt: Q9CZ04 Mouse
- SwissProt: Q5R762 Orangutan
- Unigene: 530823 Human
- Unigene: 244536 Mouse
-
Alternative names
- COP9 complex subunit 7a antibody
- COP9 constitutive photomorphogenic homolog subunit 7A antibody
- COP9 signalosome complex subunit 7a antibody
see all
Images
-
Anti-CSN7A antibody (ab235400) at 1/1000 dilution + Mouse brain tissue lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 30 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CSN7A antibody (ab235400)
Paraffin-embedded human adrenal gland tissue stained for CSN7A using ab235400 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CSN7A antibody (ab235400)
Paraffin-embedded human placenta tissue stained for CSN7A using ab235400 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235400 has not yet been referenced specifically in any publications.