Overview

  • Product name

  • Description

    Rabbit polyclonal to CSNK1G1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CSNK1G1 aa 298-422.
    Sequence:

    FFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGAS AITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAE VEVVEEAKCCCFFKRKRKKTAQRHK


    Database link: Q9HCP0-1

  • Positive control

    • WB: Jurkat, HeLa and MCF7 whole cell lysates. IHC-P: Human breast cancer and endometrial cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234727 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9130020E21Rik antibody
    • Casein kinase 1 gamma 1 antibody
    • Casein kinase I isoform gamma 1 antibody
    • Casein kinase I isoform gamma-1 antibody
    • CKI gamma 1 antibody
    • CKI-gamma 1 antibody
    • CSNK1G1 antibody
    • EC 2.7.11.1 antibody
    • KC1G1_HUMAN antibody
    see all

Images

  • All lanes : Anti-CSNK1G1 antibody (ab234727) at 1/1000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 49 kDa
    Observed band size: 49 kDa

  • Paraffin-embedded human breast cancer tissue stained for CSNK1G1 with ab234727 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tissue stained for CSNK1G1 with ab234727 at 1/100 dilution in immunohistochemical analysis.

References

ab234727 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234727.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up