Overview

  • Product name

  • Description

    Rabbit polyclonal to CSNK2A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cow
  • Immunogen

    Recombinant fragment corresponding to Human CSNK2A2 aa 8-350.
    Sequence:

    SRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEA INITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVS KTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRD VKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDY QMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYG YLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLR YDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR


    Database link: P19784

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: PC-3 and HepG2 cells.
  • General notes

     This product was previously labelled as CKII alpha prime polypeptide

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Casein kinase 2 alpha prime polypeptide antibody
    • Casein kinase II alpha' chain antibody
    • Casein kinase II subunit alpha' antibody
    • CK II alpha' antibody
    • CK II antibody
    • CK2A2 antibody
    • CKII antibody
    • CSK22_HUMAN antibody
    • CSNK2A1 antibody
    • CSNK2A2 antibody
    • FLJ43934 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for CSNK2A2 using ab238728 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma from bone) cells stained for CSNK2A2 (green) using ab238728 at 1/133 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. 

     

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for CSNK2A2 (green) using ab238728 at 1/66 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab238728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up