Overview

  • Product name

  • Description

    Rabbit polyclonal to CSP-C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cat
  • Immunogen

    Synthetic peptide corresponding to Human CSP-C aa 1-50 (N terminal).
    Sequence:

    MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG

  • Positive control

    • Jurkat Cell Lysate, human kidney tissue.
  • General notes

    Previously labelled as Granzyme H.

Properties

Applications

Our Abpromise guarantee covers the use of ab58852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 35 kDa (predicted molecular weight: 27 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1:1562500.

Target

  • Function

    Cytotoxic chymotrypsin-like serine protease with preference for bulky and aromatic residues at the P1 position and acidic residues at the P3' and P4' sites. Probably necessary for target cell lysis in cell-mediated immune responses. Participates in the antiviral response via direct cleavage of several proteins essential for viral replication.
  • Tissue specificity

    Constituvely expressed in NK cells.
  • Sequence similarities

    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Cytoplasmic granule. Cytoplasmic granules of cytolytic T-lymphocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cathepsin G like 2 antibody
    • Cathepsin G-like 2 antibody
    • CCP X antibody
    • CCP-X antibody
    • CGL 2 antibody
    • CGL2 antibody
    • CSP C antibody
    • CSP-C antibody
    • CTLA1 antibody
    • CTSGL2 antibody
    • Cytotoxic serine protease C antibody
    • Cytotoxic T lymphocyte associated serine esterase 1 antibody
    • Cytotoxic T lymphocyte proteinase antibody
    • Cytotoxic T-lymphocyte proteinase antibody
    • EC 3.4.21.- antibody
    • GRAH_HUMAN antibody
    • Granzyme H (cathepsin G-like 2, protein h-CCPX) antibody
    • Granzyme H antibody
    • GZMH antibody
    • Protein h CCPX antibody
    see all

Images

  • Anti-CSP-C antibody (ab58852) at 2.5 µg/ml + Jurkat Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50,000 - 1/100,000 dilution.

    Predicted band size: 27 kDa
    Observed band size: 35 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling CSP-C with ab58852 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnification: 400X.

References

ab58852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab58852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up