Overview

  • Product name

  • Description

    Rabbit polyclonal to CSRNP-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human CSRNP-2 aa 324-543.
    Sequence:

    VMHLQSAEELERLKAEEDSSGSSASLDSSIESLGVCILEEPLAVPEELCP GLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVE QRPVLGVKGEPGTEEGSASFPKEKDLNVFSLPVTSLVACSSTDPAALCKS EVGKTPTLEALLPEDCNPEEPENEDFHPSWSPSSLPFRTDNEEGCGMVKT SQQNEDRPPEDSSLELPLAV


    Database link: Q9H175

  • Positive control

    • WB: HepG2 whole cell lysate; Mouse heart and brain tissue lysates. IHC-P: Human testis and placenta tissues.
  • General notes

    Previously labelled as FAM130A1.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 60 kDa.

Target

  • Function

    Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity (By similarity). May play a role in apoptosis.
  • Sequence similarities

    Belongs to the AXUD1 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • C12ORF22 antibody
    • Chromosome 12 open reading frame 22 antibody
    • CSRN2_HUMAN antibody
    • CSRNP-2 antibody
    • CSRNP2 antibody
    • Cysteine serine rich nuclear protein 2 antibody
    • Cysteine/serine-rich nuclear protein 2 antibody
    • FAM130A1 antibody
    • Family with sequence similarity 130, member A1 antibody
    • Protein FAM130A1 antibody
    • TAIP-12 antibody
    • TAIP12 antibody
    • TGF beta induced apoptosis protein 12 antibody
    • TGF-beta-induced apoptosis protein 12 antibody
    see all

Images

  • All lanes : Anti-CSRNP-2 antibody (ab230029) at 1/1000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma) whole cell lysate
    Lane 3 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 60 kDa
    Observed band size: 60 kDa

  • Paraffin-embedded human testis tissue stained for CSRNP-2 using ab230029 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for CSRNP-2 using ab230029 at 1/100 dilution in immunohistochemical analysis.

References

ab230029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up