Anti-CstF-64 antibody (ab167554)
Key features and details
- Mouse polyclonal to CstF-64
- Suitable for: WB
- Reacts with: Recombinant fragment
- Isotype: IgG
Overview
-
Product name
Anti-CstF-64 antibody
See all CstF-64 primary antibodies -
Description
Mouse polyclonal to CstF-64 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Mouse, Cow, Human -
Immunogen
Recombinant full length protein corresponding to Human CstF-64 aa 1-577.
Sequence:MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYD RETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLC VQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTL IAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASM QGGVPAPGQMPAAVTGPGPGSLAPGGGMQAQVGMPGSGPVSMERGQVPMQ DPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLD GRGGRDPRGIDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAM EARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINMGAVVPQGSRQ VPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTAD QIAMLPPEQRQSILILKEQIQKSTGAP
Database link: NP_001316.1 -
Positive control
- CstF-64 transfected 293T cell line lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab167554 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa. This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein. |
Target
-
Function
One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs. -
Sequence similarities
Contains 1 RRM (RNA recognition motif) domain. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. Localized with DDX1 in cleavage bodies. - Information by UniProt
-
Database links
- Entrez Gene: 282588 Cow
- Entrez Gene: 1478 Human
- Entrez Gene: 108062 Mouse
- Omim: 300907 Human
- SwissProt: P33240 Human
- SwissProt: Q8BIQ5 Mouse
- Unigene: 132370 Human
- Unigene: 67938 Mouse
-
Alternative names
- betaCstF 64 variant 2 antibody
- CF-1 64 kDa subunit antibody
- CF1 64 kDa subunit antibody
see all
Images
Datasheets and documents
References (0)
ab167554 has not yet been referenced specifically in any publications.