Overview

  • Product name
  • Description
    Mouse polyclonal to CstF-64
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Recombinant fragment
    Predicted to work with: Mouse, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CstF-64 aa 1-577.
    Sequence:

    MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYD RETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLC VQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTL IAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASM QGGVPAPGQMPAAVTGPGPGSLAPGGGMQAQVGMPGSGPVSMERGQVPMQ DPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLD GRGGRDPRGIDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAM EARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINMGAVVPQGSRQ VPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTAD QIAMLPPEQRQSILILKEQIQKSTGAP


    Database link: NP_001316.1

  • Positive control
    • CstF-64 transfected 293T cell line lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab167554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa. This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.

Target

  • Function
    One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs.
  • Sequence similarities
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Localized with DDX1 in cleavage bodies.
  • Information by UniProt
  • Database links
  • Alternative names
    • betaCstF 64 variant 2 antibody
    • CF-1 64 kDa subunit antibody
    • CF1 64 kDa subunit antibody
    • Cleavage stimulation factor 2 antibody
    • Cleavage stimulation factor 64 kDa subunit antibody
    • Cleavage stimulation factor subunit 2 antibody
    • Cleavage stimulation factor, 3' pre RNA, subunit 2, 64kDa antibody
    • CSTF 2 antibody
    • CstF 64 antibody
    • CSTF 64 kDa subunit antibody
    • CstF-64 antibody
    • CSTF2 antibody
    • CSTF2_HUMAN antibody
    • MGC188397 antibody
    see all

Images

  • All lanes : Anti-CstF-64 antibody (ab167554) at 1 µg/ml

    Lane 1 : CstF-64 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 61 kDa

References

ab167554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up