Overview

  • Product name

  • Description

    Rabbit polyclonal to CT-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CT-1 aa 1-201.
    Sequence:

    MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ LQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPL LDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGP RAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGS A


    Database link: Q16619

  • Positive control

    • IHC-P: Human adrenal gland tissue.
  • General notes

    Previously labelled as Cardiotrophin 1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab238733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cardiophin 1 antibody
    • Cardiophin1 antibody
    • Cardiotrophin I antibody
    • Cardiotrophin-1 antibody
    • Cardiotrophin1 antibody
    • CardiotrophinI antibody
    • CT 1 antibody
    • CT-1 antibody
    • CT1 antibody
    • CTF 1 antibody
    • Ctf1 antibody
    • CTF1_HUMAN antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for CT-1 using ab238733 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

     

References

ab238733 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up