Overview

  • Product name

  • Description

    Rabbit polyclonal to CTAGE5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CTAGE5 aa 118-227.
    Sequence:

    EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMA DISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQ LQESQKQLLQ


    Database link: O15320

  • Positive control

    • WB: RT4, U-251 MG sp and A431 cell lysates. IHC-P: Human hippocampus tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 91 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Tumor-associated antigen.
  • Tissue specificity

    Isoform 5A is expressed only in testis (at the protein level). Other isoforms are expressed in several other normal tissues, including brain, muscle and cranial skin. Isoform 5A (at protein level) and isoform 5B are expressed in cutaneous T-cell lymphoma (CTCL) cell lines, colorectal carcinomas, breast carcinomas and melanoma. Isoform 5B, but not isoform 5A, is expressed in head and neck squamous cell carcinoma.
  • Involvement in disease

    Note=Autoantibodies against CTAGE5 are present in several cancer types, including benign meningioma and cutaneous T-cell lymphoma (CTCL).
  • Sequence similarities

    Belongs to the cTAGE family.
  • Information by UniProt
  • Database links

  • Alternative names

    • cTAGE 5A antibody
    • cTAGE 5B antibody
    • cTAGE 5C antibody
    • cTAGE 5D antibody
    • cTAGE family member 5 antibody
    • CTAGE family, member 5 antibody
    • CTAGE5 antibody
    • cTAGE5A antibody
    • cTAGE5B antibody
    • cTAGE5C antibody
    • cTAGE5D antibody
    • CTGE5_HUMAN antibody
    • Cutaneous T cell lymphoma associated antigen 5 antibody
    • Cutaneous T-cell lymphoma-associated antigen 5 antibody
    • MEA11 antibody
    • MEA6 antibody
    • Meningioma expressed antigen 6 (coiled coil proline rich) antibody
    • Meningioma expressed antigen 6/11 antibody
    • Meningioma-expressed antigen 6/11 antibody
    • MGEA antibody
    • MGEA11 antibody
    • MGEA6 antibody
    • Protein cTAGE 5 antibody
    • Protein cTAGE-5 antibody
    see all

Images

  • Paraffin-embedded human hippocampus tissue stained for CTAGE5 using ab224218 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-CTAGE5 antibody (ab224218) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 91 kDa

References

ab224218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up