Overview

  • Product name
  • Description
    Rabbit polyclonal to CTBP2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CTBP2 aa 1-252. (Expressed in E.coli).
    Sequence:

    MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPI LKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRV IVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNT WLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAK AFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNH HL


    Database link: P56545

  • Positive control
    • WB: Recombinant human CTBP2 protein; Pig heart lysate. IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 49 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for CTBP2 using ab232838 at 20 ug/ml in immunohistochemical analysis. DAB staining.

  • Anti-CTBP2 antibody (ab232838) at 2 µg/ml + Pig heart lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 49 kDa

  • Anti-CTBP2 antibody (ab232838) at 2 µg/ml + Recombinant human CTBP2 protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 49 kDa

References

ab232838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up