Overview

  • Product name

    Anti-CTDSP2 antibody [OTI7F5]
    See all CTDSP2 primary antibodies
  • Description

    Mouse monoclonal [OTI7F5] to CTDSP2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human CTDSP2 aa 1-271.
    Sequence:

    MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV GQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQG RICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFL RRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYV KDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIP IFEELSGAEDVYTSLGQLRAP


    Database link: O14595

  • Positive control

    • IHC-P: Human ovary adenocarcinoma tissue. WB: pCMV6-ENTRY CTDSP2 cDNA transfected HEK-293T cell lysate.
  • General notes

    Clone OTI7F5 (formerly 7F5).

Properties

Applications

Our Abpromise guarantee covers the use of ab236379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 31 kDa.
IHC-P 1/150.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

Target

  • Function

    Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells. May contribute to the development of sarcomas.
  • Tissue specificity

    Expression is restricted to non-neuronal tissues. Highest expression in pancreas and lowest in liver.
  • Sequence similarities

    Contains 1 FCP1 homology domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 2 antibody
    • Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 antibody
    • conserved gene amplified in osteosarcoma 4 antibody
    • conserved gene amplified in osteosarcoma antibody
    • CTDS2_HUMAN antibody
    • Ctdsp2 antibody
    • NIF2 antibody
    • NLI interacting factor 2 antibody
    • NLI-interacting factor 2 antibody
    • Nuclear LIM interactor interacting factor 2 antibody
    • Nuclear LIM interactor-interacting factor 2 antibody
    • OS4 antibody
    • Protein OS 4 antibody
    • Protein OS-4 antibody
    • PSR2 antibody
    • SCP2 antibody
    • Small C-terminal domain phosphatase 2 antibody
    • Small CTD phosphatase 2 antibody
    see all

Images

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for CTDSP2 with ab236379 at a 1/150 dilution in immunohistochemical analysis.

  • All lanes : Anti-CTDSP2 antibody [OTI7F5] (ab236379) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY CTDSP2 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 31 kDa

References

ab236379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up