Overview

  • Product name

    Anti-CTF18 antibody
  • Description

    Rabbit polyclonal to CTF18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CTF18 aa 881-959.
    Sequence:

    GIGEKGVHRPAPRNHEQRLEHIMRRAAREEQPEKDFFGRVVVRSTAVPSA GDTAPEQDSVERRMGTAVGRSEVWFRFNE


    Database link: Q8WVB6

  • Positive control

    • RT-4 and U-251 MG cell lysates; MCF7 cells.
  • General notes

    Previously labelled as CHTF18. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.
WB 1/100 - 1/250. Predicted molecular weight: 107 kDa.

Target

  • Function

    Chromosome cohesion factor involved in sister chromatid cohesion and fidelity of chromosome transmission. Component of one of the cell nuclear antigen loader complexes, CTF18-replication factor C (CTF18-RFC), which consists of CTF18, CTF8, DCC1, RFC2, RFC3, RFC4 and RFC5. The CTF18-RFC complex binds to single-stranded and primed DNAs and has weak ATPase activity that is stimulated by the presence of primed DNA, replication protein A (RPA) and by proliferating cell nuclear antigen (PCNA). The CTF18-RFC complex catalyzes the ATP-dependent loading of PCNA onto primed and gapped DNA. It also interacts with and stimulates DNA polymerase POLH.
  • Sequence similarities

    Belongs to the activator 1 small subunits family. CTF18 subfamily.
  • Cellular localization

    Nucleus. Associates with chromatin during S phase.
  • Information by UniProt
  • Database links

  • Alternative names

    • 6030457M03Rik antibody
    • C16orf41 antibody
    • C321D2.2 antibody
    • C321D2.3 antibody
    • C321D2.4 antibody
    • CHL12 antibody
    • chromosome transmission fidelity factor 18 homolog (S. cerevisiae) antibody
    • Chromosome transmission fidelity protein 18 homolog antibody
    • chtf18 antibody
    • Ctf18 antibody
    • CTF18_HUMAN antibody
    • hCTF18 antibody
    • MGC38008 antibody
    • RUVBL antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling CTF18 with ab220288 at 4 µg/ml (green).

     
  • All lanes : Anti-CTF18 antibody (ab220288) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 107 kDa

References

ab220288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up