Overview

  • Product name

  • Description

    Sheep polyclonal to CTHRC1
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Mouse CTHRC1 aa 33-245. NS0-derived. Full length mature form without signal peptide.
    Sequence:

    SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGI PGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTK MRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQ GSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGW NSVSRIIIEELPK


    Database link: Q9D1D6

  • Positive control

    • Mouse bone marrow tissue lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab215044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 26 kDa.

Target

Images

  • Anti-CTHRC1 antibody (ab215044) at 1/1000 dilution + mouse bone marrow tissue lysate

    Predicted band size: 26 kDa

References

ab215044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up