Overview

  • Product name

    Anti-CTNNBL1 antibody [1E4F5]
    See all CTNNBL1 primary antibodies
  • Description

    Mouse monoclonal [1E4F5] to CTNNBL1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human CTNNBL1 aa 390-557. Recombinant fragment expressed in E coli
    Sequence:

    PRKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVD RLMELHFKYL GAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYI MAEICNANVP QIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRIL


    Database link: Q8WYA6

  • Positive control

    • CTNNBL1 transfected HEK293 cells; HeLa and MCF7 cells; paraffin-embedded colon cancer and esophageal cancer tissues; HeLa, Jurkat, HEK293, A431, HepG2, and RAJI cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab201971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 65 kDa.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Induces apoptosis in CHO cells.
  • Tissue specificity

    Widely expressed with highest levels in skeletal muscle, placenta, heart, spleen, testis and thyroid.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5730471K09Rik antibody
    • Beta catenin like 1 antibody
    • Beta catenin like protein 1 antibody
    • Beta-catenin-like protein 1 antibody
    • C20orf33 antibody
    • Cadherin associated protein antibody
    • Catenin beta like 1 antibody
    • Chromosome 20 open reading frame 3 antibody
    • CTBL1_HUMAN antibody
    • CTNN protein antibody
    • CTNNBL 1 antibody
    • Ctnnbl1 antibody
    • dJ633O20.1 antibody
    • FLJ21108 antibody
    • NAP antibody
    • Nuclear associated protein antibody
    • nuclear protein NAP antibody
    • Nuclear-associated protein antibody
    • NYD SP19 antibody
    • OTTMUSP00000016933 antibody
    • P14 antibody
    • P14L antibody
    • PP8304 antibody
    • RP5 1118M15.1 antibody
    • Testis development protein NYD SP19 antibody
    • Testis development protein NYD-SP19 antibody
    see all

Images

  • Anti-CTNNBL1 antibody [1E4F5] (ab201971) at 1/500 dilution + human CTNNBL1 (aa: 390-557) recombinant protein.

    Predicted band size: 65 kDa

  • All lanes : Anti-CTNNBL1 antibody [1E4F5] (ab201971) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : CTNNBL1 (aa 390-557)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 65 kDa

  • All lanes : Anti-CTNNBL1 antibody [1E4F5] (ab201971) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : Jurkat cell lysate
    Lane 3 : HEK293 cell lysate
    Lane 4 : A431 cell lysate
    Lane 5 : HepG2 cell lysate
    Lane 6 : Raji cell lysate

    Predicted band size: 65 kDa

  • Immunofluorescence analysis of MCF-7 cells labeling CTNNBL1 using ab201971 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. 

  • Flow cytometric analysis of Hela cells labeling CTNNBL1 using ab201971 at 1/200 dilution (green) and negative control (red).

  • Immunohistochemical analysis of paraffin-embedded colon cancer tissue labeling CTNNBL1 with ab201971 at 1/200 dilution with DAB staining.

  • Immunohistochemical analysis of paraffin-embedded esophageal cancer tissue labeling CTNNBL1 using ab201971 at 1/200 dilution with DAB staining.

References

ab201971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up