Overview

  • Product name

    Anti-CTP synthase/CTPS antibody
    See all CTP synthase/CTPS primary antibodies
  • Description

    Rabbit polyclonal to CTP synthase/CTPS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Sheep, Rabbit, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human CTP synthase/CTPS aa 541-591 (C terminal). The exact sequence is proprietary. (NP_001896.2).
    Sequence:

    FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH D


    Database link: P17812

  • Positive control

    • HeLa, 293T, Jurkat, TCMK1 and NIH-3T3 whole cell lysates.
  • General notes

     This product was previously labelled as CTP synthase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab192988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 67 kDa.
IP Use at an assay dependent concentration.

Target

  • Relevance

    CTP synthase (CTPS) catalyzes the ATP-dependent conversion of UTP to CTP using either L-glutamine or ammonia as the source of nitrogen. The enzyme is important in the biosynthesis nucleic acids. It has a key role in cell growth, development, and tumorigenesis.
  • Cellular localization

    Cytosol, membrane
  • Database links

  • Alternative names

    • CTP synthase 1 antibody
    • CTP synthase antibody
    • CTP synthetase 1 antibody
    • CTP synthetase antibody
    • CTPS antibody
    • Cytidine 5 prime triphosphate synthetase antibody
    • Cytidine 5' triphosphate synthetase antibody
    • IMD24 antibody
    • UTP ammonia ligase 1 antibody
    see all

Images

  • All lanes : Anti-CTP synthase/CTPS antibody (ab192988) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 67 kDa


    Exposure time: 30 seconds


    Lysates prepared using NETN lysis buffer.

  • Detection of CTP synthase/CTPS in immunoprecipitates of 293T whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab192988 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab192988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up