Overview

  • Product name

    Anti-CTP synthase/CTPS antibody
    See all CTP synthase/CTPS primary antibodies
  • Description

    Rabbit polyclonal to CTP synthase/CTPS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human CTP synthase/CTPS aa 79-388.
    Sequence:

    DIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQ ALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNI HVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKE KISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQP RKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAI NHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGT EGKIQAIAWA


    Database link: P17812

  • Positive control

    • WB: HeLa and HEK-293T cell lysate. IHC-P: Human pancreas and breast cancer tissue.
  • General notes

     This product was previously labelled as CTP synthase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    CTP synthase (CTPS) catalyzes the ATP-dependent conversion of UTP to CTP using either L-glutamine or ammonia as the source of nitrogen. The enzyme is important in the biosynthesis nucleic acids. It has a key role in cell growth, development, and tumorigenesis.
  • Cellular localization

    Cytosol, membrane
  • Database links

  • Alternative names

    • CTP synthase 1 antibody
    • CTP synthase antibody
    • CTP synthetase 1 antibody
    • CTP synthetase antibody
    • CTPS antibody
    • Cytidine 5 prime triphosphate synthetase antibody
    • Cytidine 5' triphosphate synthetase antibody
    • IMD24 antibody
    • UTP ammonia ligase 1 antibody
    see all

Images

  • Paraffin-embedded human pancreatic tissue stained for CTP synthase/CTPS using ab235000 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-CTP synthase/CTPS antibody (ab235000) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit at 1/10000 dilution
  • Paraffin-embedded human breast cancer tissue stained for CTP synthase/CTPS using ab235000 at 1/100 dilution in immunohistochemical analysis.

References

ab235000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up