Overview

  • Product name

  • Description

    Rabbit polyclonal to CTRB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CTRB1 aa 19-263.
    Sequence:

    CGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISED WVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVN NDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANK TPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLV CQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAAN


    Database link: P17538

  • Positive control

    • WB: Mouse spleen and stomach tissue lysates. IHC-P: Human pancreatic tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 28 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    CTRB1 (Chymotrypsinogen B1) is the inactive precursor of Alpha chymotrypsin, one of a family of serine proteases secreted into the gastrointestinal tract. The zymogen is activated by proteolytic cleavage by trypsin.
  • Cellular localization

    Secreted, extracellular space.
  • Database links

  • Alternative names

    • Chymotrypsinogen B antibody
    • Chymotrypsinogen B1 antibody
    • ChymotrypsinogenB antibody
    • ChymotrypsinogenB1 antibody
    • CTRB 1 antibody
    • CTRB antibody
    • FLJ42412 antibody
    • MGC88037 antibody
    • OTTHUMP00000214638 antibody
    see all

Images

  • All lanes : Anti-CTRB1 antibody (ab235053) at 1/500 dilution

    Lane 1 : Mouse spleen tissue lysate
    Lane 2 : Mouse stomach tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 28 kDa

  • Paraffin-embedded human pancreatic tissue stained for CTRB1 using ab235053 at 1/100 dilution in immunohistochemical analysis.

References

ab235053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up