Overview

  • Product name

    Anti-CTRB2 antibody
  • Description

    Rabbit polyclonal to CTRB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CTRB2 aa 34-263. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    IVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDV VVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFS QTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSN AECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSW GSRTCSTTTPAVYARVAKLIPWVQKILAAN


    Database link: Q6GPI1

  • Positive control

    • IHC-P: Human pancreas tissue. WB: BxPC-3 cell lysate; Recombinant human CTRB2 protein.
  • General notes

     This product was previously labelled as Chymotrypsinogen B2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231284 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab231284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 28 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for CTRB2 using ab231284 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CTRB2 antibody (ab231284) at 2 µg/ml + Recombinant human CTRB2 protein.

    Predicted band size: 28 kDa

  • Anti-CTRB2 antibody (ab231284) at 2 µg/ml + BxPC-3 (human pancreas adenocarcinoma cell line) cell lysate.

    Predicted band size: 28 kDa

References

ab231284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up