Overview

  • Product name

  • Description

    Rabbit polyclonal to CTRP12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CTRP12 aa 70-138.
    Sequence:

    DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLH EFQELLKEATERRFSGLLD

  • Positive control

    • Human colon tissue.
  • General notes

    Previously labelled as FAM132A. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the FAM132 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adipolin antibody
    • Adipose derived insulin sensitizing factor antibody
    • C1q domain containing 2 antibody
    • C1q/TNF related protein 12 antibody
    • C1QDC2 antibody
    • C1QTNF12 antibody
    • CTRP12 antibody
    • F132A_HUMAN antibody
    • Fam132a antibody
    • Protein FAM132A antibody
    see all

Images

  • ab121791, at 1/75 dilution, staining CTRP12 in paraffin-embedded Human colon tissue, by Immunohistochemistry.

References

ab121791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up