Overview

  • Product name

    Anti-CTRP12 antibody - N-terminal
    See all CTRP12 primary antibodies
  • Description

    Rabbit polyclonal to CTRP12 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human CTRP12 aa 1-50 (N terminal). The exact sequence is proprietary. (NP_001014980).
    Sequence:

    MRRWAWAAVVVLLGPQLVLLGGVGARREAQRTQQPGQRADPPNATASASS


    Database link: Q5T7M4

  • Positive control

    • MCF7 whole cell lysate.
  • General notes

    Previously labelled as FAM132A. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa.

Target

  • Sequence similarities

    Belongs to the FAM132 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adipolin antibody
    • Adipose derived insulin sensitizing factor antibody
    • C1q domain containing 2 antibody
    • C1q/TNF related protein 12 antibody
    • C1QDC2 antibody
    • C1QTNF12 antibody
    • CTRP12 antibody
    • F132A_HUMAN antibody
    • Fam132a antibody
    • Protein FAM132A antibody
    see all

Images

  • Anti-CTRP12 antibody - N-terminal (ab177991) at 1 µg/ml + MCF7 whole cell lysate at 10 µg

    Predicted band size: 32 kDa

References

ab177991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up