Overview

  • Product name

    Anti-CTRP8 antibody
  • Description

    Rabbit polyclonal to CTRP8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse, Cow, Cat
  • Immunogen

    Synthetic peptide corresponding to Human CTRP8 aa 194-243 (C terminal).
    Sequence:

    AQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSG


    Database link: NP_997302

  • Positive control

    • Human fetal liver lysate
  • General notes

    Previously labelled as C1QTNF8.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Tissue specificity

    Expressed predominantly in lung and testis.
  • Sequence similarities

    Contains 1 C1q domain.
    Contains 1 collagen-like domain.
  • Post-translational
    modifications

    No N-glycosylation.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1q and tumor necrosis factor related protein 8 antibody
    • C1q/TNF-related protein 8 antibody
    • C1QT8_HUMAN antibody
    • C1QTNF8 antibody
    • Complement C1q tumor necrosis factor-related protein 8 antibody
    • CTRP8 antibody
    • UNQ5829 antibody
    • UNQ5829/PRO19648 antibody
    see all

Images

  • Anti-CTRP8 antibody (ab140276) at 1 µg/ml + Human fetal liver lysate at 10 µg

    Predicted band size: 28 kDa

References

ab140276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up