Overview

  • Product name

    Anti-CTRP9B antibody
  • Description

    Rabbit polyclonal to CTRP9B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CTRP9B aa 2-192.
    Sequence:

    RIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGD KGDAGEPGCPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHG PKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLP GPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGK


    Database link: B2RNN3-1

  • Positive control

    • IHC-P: Human brain and testis tissues. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as C1QTNF9B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab234641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Expressed at low levels. Not expressed in adipose tissues.
  • Sequence similarities

    Contains 1 C1q domain.
    Contains 3 collagen-like domains.
  • Cellular localization

    Secreted. Heteromeric complex formation with CTRP9A or ADIPOQ is required for secretion, otherwise, it is retained in the endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1q/TNF-related protein 9B antibody
    • C1QTNF9B antibody
    • C1T9B_HUMAN antibody
    • Complement C1q and tumor necrosis factor-related protein 9-like antibody
    • Complement C1q and tumor necrosis factor-related protein 9B antibody
    • CTRP9B antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for CTRP9B (green) using ab234641 at 1/100 dilution in ICC/IF, followed by Alexa-Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human brain tissue stained for CTRP9B using ab234641 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for CTRP9B using ab234641 at 1/100 dilution in immunohistochemical analysis.

References

ab234641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up