Overview

  • Product name

  • Description

    Rabbit polyclonal to Cubilin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Cubilin aa 2141-2280.
    Sequence:

    PNGDSSCNQGDYLVLRNGPDIYSPPLGPPGGNGHFCGSHASSTLFTSDNQ MFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHN YPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL


    Database link: O60494

  • Positive control

    • IHC-P: Human small intestine, stomach, kidney, colon and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Cotransporter which plays a role in lipoprotein, vitamin and iron metabolism, by facilitating their uptake. Binds to ALB, MB, Kappa and lambda-light chains, TF, hemoglobin, GC, SCGB1A1, APOA1, high density lipoprotein, and the GIF-cobalamin complex. The binding of all ligands requires calcium. Serves as important transporter in several absorptive epithelia, including intestine, renal proximal tubules and embryonic yolk sac. Interaction with LRP2 mediates its trafficking throughout vesicles and facilitates the uptake of specific ligands like GC, hemoglobin, ALB, TF and SCGB1A1. Interaction with AMN controls its trafficking to the plasma membrane and facilitates endocytosis of ligands. May play an important role in the development of the peri-implantation embryo through internalization of APOA1 and cholesterol. Binds to LGALS3 at the maternal-fetal interface.
  • Tissue specificity

    Expressed in kidney proximal tubule cells, placenta, visceral yolk-sac cells and in absorptive intestinal cells. Expressed in the epithelium of intestine and kidney.
  • Involvement in disease

    Recessive hereditary megaloblastic anemia 1
  • Sequence similarities

    Contains 27 CUB domains.
    Contains 7 EGF-like domains.
  • Domain

    The CUB domains 5 to 8 mediate binding to GIF and ALB. CUB domains 1 and 2 mediate interaction with LRP2.
  • Post-translational
    modifications

    The precursor is cleaved by a trans-Golgi proteinase furin. The result is a propeptide cleaved off.
    N-glycosylated.
  • Cellular localization

    Endosome membrane. Lysosome membrane. Colocalizes with AMN and LRP2 in the endocytotic apparatus of epithelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • 460 kDa receptor antibody
    • cubilin (intrinsic factor-cobalamin receptor) antibody
    • Cubilin antibody
    • Cubilin precursor antibody
    • Cubn antibody
    • CUBN_HUMAN antibody
    • IFCR antibody
    • Intestinal intrinsic factor receptor antibody
    • intrinsic factor B12-receptor antibody
    • Intrinsic factor-cobalamin receptor antibody
    • Intrinsic factor-vitamin B12 receptor antibody
    • megaloblastic anemia 1 antibody
    • MGA1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Cubilin using ab244274 at 1/500 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human small intestine tissue stained for Cubilin using ab244274 at 1/500 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human testis tissue stained for Cubilin using ab244274 at 1/500 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Cubilin using ab244274 at 1/500 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human colon tissue stained for Cubilin using ab244274 at 1/500 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human lymph node tissue stained for Cubilin using ab244274 at 1/500 dilution in immunohistochemical analysis.

    Negative control.

References

ab244274 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up