Anti-CUG-BP1 antibody (ab244474)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CUG-BP1 antibody
See all CUG-BP1 primary antibodies -
Description
Rabbit polyclonal to CUG-BP1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Chicken, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human CUG-BP1 aa 195-266.
Sequence:KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNL NTLSSLHPMGGLNAMQLQNLAA
Database link: Q92879 -
Positive control
- WB: U-251 MG cell lysate. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244474 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 52 kDa. |
Target
-
Function
RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Activates SM exon 5 inclusion by antagonizing the repressive effect of PTB. Promotes exclusion of exon 11 of the INSR pre-mRNA. Inhibits, together with HNRNPH1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Increases translation and controls the choice of translation initiation codon of CEBPB mRNA. Increases mRNA translation of CEBPB in aging liver (By similarity). Increases translation of CDKN1A mRNA by antagonizing the repressive effect of CALR3. Mediates rapid cytoplasmic mRNA deadenylation. Recruits the deadenylase PARN to the poly(A) tail of EDEN-containing mRNAs to promote their deadenylation. Required for completion of spermatogenesis (By similarity). Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK and to Bruno response elements (BREs). Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA. Binds to AU-rich sequences (AREs or EDEN-like) localized in the 3'-UTR of JUN and FOS mRNAs. Binds to the IR RNA. Binds to the 5'-region of CDKN1A and CEBPB mRNAs. Binds with the 5'-region of CEBPB mRNA in aging liver. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the CELF/BRUNOL family.
Contains 3 RRM (RNA recognition motif) domains. -
Post-translational
modificationsPhosphorylated. Its phosphorylation status increases in senescent cells. -
Cellular localization
Nucleus. Cytoplasm. RNA-binding activity is detected in both nuclear and cytoplasmic compartments. - Information by UniProt
-
Database links
- Entrez Gene: 10658 Human
- Entrez Gene: 13046 Mouse
- Omim: 601074 Human
- SwissProt: Q5F3T7 Chicken
- SwissProt: Q92879 Human
- SwissProt: P28659 Mouse
- Unigene: 595333 Human
- Unigene: 29495 Mouse
see all -
Alternative names
- 50 kDa Nuclear polyadenylated RNA binding protein antibody
- 50 kDa nuclear polyadenylated RNA-binding protein antibody
- Bruno like 2 antibody
see all
Images
-
Western blot - Anti-CUG-BP1 antibody (ab244474)All lanes : Anti-CUG-BP1 antibody (ab244474) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Predicted band size: 52 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-CUG-BP1 antibody (ab244474)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for CUG-BP1 (green) using ab244474 at 4 μg/ml in ICC/IF.
Datasheets and documents
References
ab244474 has not yet been referenced specifically in any publications.
