Overview

  • Product name

    Anti-Cullin 3/CUL-3 antibody
    See all Cullin 3/CUL-3 primary antibodies
  • Description

    Rabbit polyclonal to Cullin 3/CUL-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Cullin 3/CUL-3 aa 569-768.
    Sequence:

    KEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQ ETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSK LHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQ HNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA


    Database link: Q13618

  • Positive control

    • Jurkat whole cell lysate (ab7899). HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab194584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 89 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the BCR complex depends on the BTB domain-containing protein as the susbstrate recognition component. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, H2AFY and DAXX, and probably GLI2 or GLI3. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition.
  • Tissue specificity

    Widely expressed.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the cullin family.
  • Post-translational
    modifications

    Neddylated. Attachment of NEDD8 is required for the E3 ubiquitin-protein ligase activity of the BCR complex. Deneddylated via its interaction with the COP9 signalosome (CSN) complex.
  • Cellular localization

    Nucleus. Golgi apparatus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CUL 3 antibody
    • Cul-3 antibody
    • cul3 antibody
    • CUL3_HUMAN antibody
    • Cullin 3 antibody
    • Cullin-3 antibody
    • Cullin3 antibody
    • KIAA0617 antibody
    • PHA2E antibody
    see all

Images

  • Anti-GPR37L1 antibody (ab194568) at 1/500 dilution + Jurkat cell lysate

    Predicted band size: 89 kDa

  • Immunofluorescence analysis of HeLa cells labeling Cullin 3/CUL-3 with ab194584 at a 1/50 dilution.

    Blue: DAPI for nuclear staining.

References

ab194584 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up