Overview

  • Product name

    Anti-Cullin 5/CUL-5 antibody
    See all Cullin 5/CUL-5 primary antibodies
  • Description

    Rabbit polyclonal to Cullin 5/CUL-5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Cullin 5/CUL-5 aa 1-300.
    Sequence:

    MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAV CLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKF FTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSN IKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRD NFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLE TRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLM


    Database link: Q93034

  • Positive control

    • IHC-P: Human tonsil and kidney tissue.
  • General notes

    Previously labelled as Cullin 5. 

Properties

Applications

Our Abpromise guarantee covers the use of ab238119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Core component of multiple SCF-like ECS (Elongin-Cullin 2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition component. ECS(SOCS1) seems to direct ubiquitination of JAK2. Seems to be involved in proteosomal degradation of p53/TP53 stimulated by adenovirus E1B-55 kDa protein. May form a cell surface vasopressin receptor.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the cullin family.
  • Post-translational
    modifications

    Neddylated; which enhances the ubiquitination activity of SCF and prevents binding of the inhibitor CAND1. Deneddylated via its interaction with the COP9 signalosome (CSN).
  • Information by UniProt
  • Database links

  • Alternative names

    • CUL 5 antibody
    • CUL-5 antibody
    • CUL5 antibody
    • CUL5_HUMAN antibody
    • Cullin 5 antibody
    • Cullin-5 (vasopressin-activated calcium-mobilizing receptor-1) antibody
    • Cullin-5 antibody
    • Cullin5 antibody
    • VACM 1 antibody
    • VACM-1 antibody
    • VACM1 antibody
    • Vasopressin activated calcium mobilizing receptor 1 antibody
    • Vasopressin activated calcium mobilizing receptor antibody
    • Vasopressin-activated calcium-mobilizing receptor 1 antibody
    • Vasopressin-activated calcium-mobilizing receptor-1 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for Cullin 5/CUL-5 with ab238119 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for Cullin 5/CUL-5 with ab238119 at a 1/100 dilution in immunohistochemical analysis.

References

ab238119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up