Anti-Cullin 7/CUL-7 antibody (ab223755)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Cullin 7/CUL-7 antibody
See all Cullin 7/CUL-7 primary antibodies -
Description
Rabbit polyclonal to Cullin 7/CUL-7 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rat, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human Cullin 7/CUL-7 aa 60-142.
Sequence:CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEE METDVKSLIQRALRQLEECVGTIPPAPLLHTVH
Database link: Q14999 -
Positive control
- IHC-P: Human skeletal muscle tissue.
-
General notes
This product was previously labelled as CUL-7
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab223755 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Component of a probable SCF-like E3 ubiquitin-protein ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably plays a role in the degradation of proteins involved in endothelial proliferation and/or differentiation (By similarity). Seems not to promote polyubiquitination and proteasomal degradation of TP53. In vitro, complexes of CUL7 with either CUL9 or FBXW8 or TP53 contain E3 ubiquitin-protein ligase activity. -
Tissue specificity
Highly expressed in fetal kidney and adult skeletal muscle. Also abundant in fetal brain, as well as in adult pancreas, kidney, placenta and heart. Detected in trophoblasts, lymphoblasts, osteoblasts, chondrocytes and skin fibroblasts. -
Pathway
Protein modification; protein ubiquitination. -
Involvement in disease
Defects in CUL7 are the cause of 3M syndrome type 1 (3M1) [MIM:273750]. An autosomal recessive disorder characterized by severe pre- and postnatal growth retardation, facial dysmorphism, large head circumference, and normal intelligence and endocrine function. Skeletal changes include long slender tubular bones and tall vertebral bodies. -
Sequence similarities
Belongs to the cullin family.
Contains 1 DOC domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 9820 Human
- Entrez Gene: 100172168 Orangutan
- Entrez Gene: 363191 Rat
- Omim: 609577 Human
- SwissProt: Q14999 Human
- SwissProt: Q5RCJ3 Orangutan
- Unigene: 520136 Human
-
Alternative names
- CUL-7 antibody
- CUL7 antibody
- CUL7_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cullin 7/CUL-7 antibody (ab223755)Paraffin-embedded human skeletal muscle tissue stained for Cullin 7/CUL-7 using ab223755 at 1/50 dilution in immunohistochemical analysis.
Protocols
Datasheets and documents
References
ab223755 has not yet been referenced specifically in any publications.
