Overview

  • Product name

    Anti-Cullin 7/CUL-7 antibody
    See all Cullin 7/CUL-7 primary antibodies
  • Description

    Rabbit polyclonal to Cullin 7/CUL-7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Cullin 7/CUL-7 aa 60-142.
    Sequence:

    CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEE METDVKSLIQRALRQLEECVGTIPPAPLLHTVH


    Database link: Q14999

  • Positive control

    • IHC-P: Human skeletal muscle tissue.
  • General notes

    This product was previously labelled as CUL-7

     

Properties

Applications

Our Abpromise guarantee covers the use of ab223755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Component of a probable SCF-like E3 ubiquitin-protein ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably plays a role in the degradation of proteins involved in endothelial proliferation and/or differentiation (By similarity). Seems not to promote polyubiquitination and proteasomal degradation of TP53. In vitro, complexes of CUL7 with either CUL9 or FBXW8 or TP53 contain E3 ubiquitin-protein ligase activity.
  • Tissue specificity

    Highly expressed in fetal kidney and adult skeletal muscle. Also abundant in fetal brain, as well as in adult pancreas, kidney, placenta and heart. Detected in trophoblasts, lymphoblasts, osteoblasts, chondrocytes and skin fibroblasts.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Defects in CUL7 are the cause of 3M syndrome type 1 (3M1) [MIM:273750]. An autosomal recessive disorder characterized by severe pre- and postnatal growth retardation, facial dysmorphism, large head circumference, and normal intelligence and endocrine function. Skeletal changes include long slender tubular bones and tall vertebral bodies.
  • Sequence similarities

    Belongs to the cullin family.
    Contains 1 DOC domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CUL-7 antibody
    • CUL7 antibody
    • CUL7_HUMAN antibody
    • Cullin 7 antibody
    • Cullin-7 antibody
    • dJ20C7.5 antibody
    • KIAA0076 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for Cullin 7/CUL-7 using ab223755 at 1/50 dilution in immunohistochemical analysis.

References

ab223755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up