Overview

  • Product name

  • Description

    Rabbit polyclonal to Cux2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human Cux2 aa 1030-1080 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GSQAPGGIQEIVAMSPELDTYSITKRVKEVLTDNNLGQRLFGESILGLTQ G


    Database link: O14529

  • Positive control

    • Rat brain and mouse embryo tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab216588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Cux2 with ab216588 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryo tissue labeling Cux2 with ab216588 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References

ab216588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up