Anti-Cux2 antibody (ab216588)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Cux2 antibody
See all Cux2 primary antibodies -
Description
Rabbit polyclonal to Cux2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human -
Immunogen
Synthetic peptide within Human Cux2 aa 1030-1080 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:GSQAPGGIQEIVAMSPELDTYSITKRVKEVLTDNNLGQRLFGESILGLTQ G
Database link: O14529 -
Positive control
- Rat brain and mouse embryo tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
ELISA pair antibody
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab216588 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. |
Target
-
Function
May be a transcription factor involved in neural specification. Binds to DNA in a sequence-specific manner. -
Sequence similarities
Belongs to the CUT homeobox family.
Contains 3 CUT DNA-binding domains.
Contains 1 homeobox DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 23316 Human
- Entrez Gene: 13048 Mouse
- Entrez Gene: 288665 Rat
- Omim: 610648 Human
- SwissProt: O14529 Human
- SwissProt: P70298 Mouse
- Unigene: 124953 Human
- Unigene: 156172 Mouse
see all -
Alternative names
- CDP2 antibody
- Cut like homeobox 2 antibody
- Cut-like 2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cux2 antibody (ab216588)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Cux2 with ab216588 at 1/200 dilution, followed by secondary antibody detection and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cux2 antibody (ab216588)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryo tissue labeling Cux2 with ab216588 at 1/200 dilution, followed by secondary antibody detection and DAB staining.
Protocols
Datasheets and documents
References
ab216588 has not yet been referenced specifically in any publications.