Anti-Cux2 antibody (ab216588)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to Cux2
  • Suitable for: IHC-P
  • Reacts with: Mouse, Rat
  • Isotype: IgG

Overview

  • Product name

    Anti-Cux2 antibody

  • Description

    Rabbit polyclonal to Cux2

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-Pmore details

  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human

  • Immunogen

    Synthetic peptide within Human Cux2 aa 1030-1080 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GSQAPGGIQEIVAMSPELDTYSITKRVKEVLTDNNLGQRLFGESILGLTQ G


    Database link: O14529

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Rat brain and mouse embryo tissues.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab216588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cux2 antibody (ab216588)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cux2 antibody (ab216588)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Cux2 with ab216588 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cux2 antibody (ab216588)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cux2 antibody (ab216588)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryo tissue labeling Cux2 with ab216588 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References (0)

Publishing research using ab216588? Please let us know so that we can cite the reference in this datasheet.

ab216588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab216588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com