Overview

  • Product name

    Anti-CUZD1/Erg1 antibody
  • Description

    Rabbit polyclonal to CUZD1/Erg1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse CUZD1/Erg1 aa 291-545. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    ALNYNESNLQLNDPTCRPNVSNVIEFSIPLHECGTVKKIEDHAISYTNRI TFIESPVSAVITRQKLLQIVVTCEMEYNSTVEIMYITEDDIIQNQSVLGK YNTSLALYESDSFENLVQESPYYVDLNQTLFVQATLHTSDPSLVVFLDTC RASPTSDFASPTYDLISSGCCQDETCKVYPLFGHYGRFQFNAFKFLKHLN SVYLKCKILICDNNDQTSRCNQGCVPRRKRDIPSYKWKTDSVIGPIRLKR DRSA


    Database link: P70412

  • Positive control

    • IHC-P: Mouse uterus and pancreas tissues. WB: Mouse ovary lysate; Recombinant mouse CUZD1/Erg1 protein.
  • General notes

     This product was previously labelled as CUZD1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231173 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab231173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 68 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    CUZD1 antiserum inhibits cell attachment and proliferation of ovarian cancer cells so may be involved in these processes. May also play a role in the uterus during late pregnancy and/or in trypsin activation in pancreatic acinar cells.
  • Tissue specificity

    Detected in pancreas and epithelium of ovary. Expressed at higher levels in ovarian tumors than in normal tissue.
  • Sequence similarities

    Contains 2 CUB domains.
    Contains 1 ZP domain.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle membrane. Associated with zymogen granule membranes.
  • Information by UniProt
  • Database links

  • Alternative names

    • CUB and zona pellucida-like domain-containing protein 1 antibody
    • CUB and ZP domain-containing protein 1 antibody
    • CUZD1 antibody
    • CUZD1_HUMAN antibody
    • Transmembrane protein UO-44 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse uterus tissue stained for CUZD1/Erg1 using ab231173 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse pancreas tissue stained for CUZD1/Erg1 using ab231173 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CUZD1/Erg1 antibody (ab231173) at 2 µg/ml + Recombinant mouse CUZD1/Erg1 protein

    Predicted band size: 68 kDa

  • Anti-CUZD1/Erg1 antibody (ab231173) at 2 µg/ml + Mouse ovary lysate

    Predicted band size: 68 kDa

References

ab231173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up