Overview

  • Product name

    Anti-CWF19L2 antibody
  • Description

    Rabbit polyclonal to CWF19L2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CWF19L2 aa 325-533.
    Sequence:

    SPERESIHILSVDEKNKLGAKIIKAEMMGNMELAEQLKVQLEKANKFKET ITQIPKKSGVENEDQQEVILVRTDQSGRVWPVNTPGKSLESQGGRRKRQM VSTHEKRERVRYFHDDDNLSLNDLVKNEKMGTAENQNKLFMRMASKFMGK TDGDYYTLDDMFVSKAAERERLGEEEENQRKKAIAEHRSLAAQMEKCLYC FDSSQFPKH


    Database link: BC110442

  • Positive control

    • Human fetal liver lysate; Human testis tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200ul Sterile Distilled Water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 86, 104 kDa.
IHC-P 1/100 - 1/500.

Target

Images

  • Immunohistochemical analysis of Formalin-fixed, Paraffin-embedded Human testis tissue labeling CWF19L2 with ab201203 at 1/100 dilution.

  • Anti-CWF19L2 antibody (ab201203) at 1/1000 dilution + Human fetal liver lysate

    Predicted band size: 86, 104 kDa

References

ab201203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up