Anti-CWH43 antibody (ab185120)
Key features and details
- Rabbit polyclonal to CWH43
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CWH43 antibody -
Description
Rabbit polyclonal to CWH43 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rat
-
Immunogen
Recombinant fragment corresponding to Human CWH43 aa 413-501.
Sequence:KAYERKLGKVAPTKEVSAAIWPFRFGYDNEGWSSLERSAHLLNETGADFI TILESDASKPYMGNNDLTMWLGEKLGFYTDFGPSTRYHT
Database link: Q9H720 -
Positive control
- Human breast tissue
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab185120 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol |
Target
-
Function
Involved in lipid remodeling during GPI-anchor maturation. -
Sequence similarities
Belongs to the PGAP2IP family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 80157 Human
- Entrez Gene: 305307 Rat
- SwissProt: Q9H720 Human
- Unigene: 479703 Human
- Unigene: 40896 Rat
-
Alternative names
- C130090K23Rik antibody
- cell wall biogenesis 43 C terminal homolog antibody
- Cell wall biogenesis protein 43 C-terminal homolog antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CWH43 antibody (ab185120)
Immunohistochemical analysis of paraffin-embedded Human breast tissue, labeling CWH43 with ab185120 at 1/500 dilution.
Datasheets and documents
References (0)
ab185120 has not yet been referenced specifically in any publications.
