Overview

  • Product name

  • Description

    Rabbit polyclonal to Cx36
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-FoFr, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Cx36 aa 272-321. NP_065711
    Sequence:

    LNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAYV

  • Positive control

    • Jurkat whole cell lysate (ab7899)
  • General notes

    Protein previously known as Connexin 36/GJA9.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: PBS, 2% Sucrose
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab86408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-FoFr Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Male mouse (P41) was anesthetized with isoflurane until they became non-responsive to tail pinch. Animal's thoracic cavity opened and it was transcardially perfused with 10 mL of ice cold PBS, then 10 mL of Ice cold 4 % PFA solution. Brain was removed and fixed overnight in 4% PFA. Next morning brain was rinsed 3X in PBS. Brain was immersed in agar and sliced at a thickness of 50uM. Brain slices were incubated overnight in a solution of PBST (0.2%) + 10% Normal GOAT serum + a monoclonal mouse anti-Parvalbumin antibody (1:2000)+ ab86408 (1ug/mL) and gently shaken overnight at 4°C. Samples were washed 6x in PBS (10 min each at RT) and exposed to secondary antibodies at 4°C: PBST (0.3%) + 10% normal goat serum + anti-mouse Alexa 488 (1:1000) + Anti-rabbit Alexa 555 (1:1000). Samples were washed 6x in PBST mounted. Images acquired with a confocal microscope at 63X.

  • Anti-Cx36 antibody (ab86408) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 36 kDa



    Gel concentration 12%

References

This product has been referenced in:

  • Kovács-Öller T  et al. Connexin36 Expression in the Mammalian Retina: A Multiple-Species Comparison. Front Cell Neurosci 11:65 (2017). Read more (PubMed: 28337128) »
  • Franco-Pérez J  et al. Sleep deprivation and sleep recovery modifies connexin36 and connexin43 protein levels in rat brain. Neuroreport 23:103-7 (2012). Read more (PubMed: 22158029) »
See all 2 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Mouse Tissue lysate - whole (Retina)
Gel Running Conditions
Reduced Denaturing (NOVEX 4-20% Tris-Glycine)
Loading amount
20 µg
Treatment
Contains untreated samples and retinas from mice exposed to high intensity light
Specification
Retina
Blocking step
Odyssey buffer / TBS as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 50% · Temperature: 22°C

Marcus Hooper

Verified customer

Submitted May 17 2016

Answer

Thank you for contacting us.

ab86408 and ab48814 are fully characterized with human lysates in western blot. The image is published on the datasheet and the antibodies are fully guaranteed for human lysates.

Cow (bovine) is predicted species based on sequence homology between human and Cow. We can not 100% guarantee that these abs will detect the bovine protein however we can ask a question if the immunogen is similar then why these should not be detecting. Theoretically, it is more likely that the antibodies will cross react.

In order to get the guarantee for both of these product I would recommend using human cell lysates as positive control. If in case the antibody show unexpected results with human lysates we will be happy to replace the antibodies.

Secondly, we can provide 100% Abreview discount code for use of these antibodies in WB.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up