Overview

  • Product name

  • Description

    Rabbit polyclonal to Cx37/GJA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Cx37/GJA4 aa 1-333.
    Sequence:

    MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQS DFECNTAQPG CTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIY LSRREERLRQKEGELRALPAKD PQVERALAAVERQMAKISVAEDGRLR IRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWT MEPVFVCQRAPCPY LVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGM RA RQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWA NLTTEERL ASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV


    Database link: P35212

  • Positive control

    • SW620, BT474, 293T and H460 whole cell lysates.
  • General notes

    Previously labelled as Connexin 37 / GJA4.

Properties

Applications

Our Abpromise guarantee covers the use of ab185820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 37 kDa.

Target

  • Function

    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Tissue specificity

    Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.
  • Sequence similarities

    Belongs to the connexin family. Alpha-type (group II) subfamily.
  • Cellular localization

    Cell membrane. Cell junction > gap junction.
  • Information by UniProt
  • Database links

  • Alternative names

    • Connexin 37 antibody
    • Connexin-37 antibody
    • Cx37 antibody
    • CXA4_HUMAN antibody
    • Gap junction alpha 4 protein antibody
    • Gap junction alpha-4 protein antibody
    • gap junction protein, alpha 4 37kDa (connexin 37) antibody
    • gap junction protein, alpha 4, 37kD (connexin 37) antibody
    • Gap junction protein, alpha 4, 37kDa antibody
    • Gja4 antibody
    • OTTHUMP00000004181 antibody
    • OTTHUMP00000004182 antibody
    see all

Images

  • All lanes : Anti-Cx37/GJA4 antibody (ab185820) at 1/500 dilution

    Lane 1 : SW620 cell lysate
    Lane 2 : BT474 cell lysate
    Lane 3 : 293T cell lysate
    Lane 4 : H460 cell lysate

    Predicted band size: 37 kDa

References

ab185820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up