Overview

  • Product name

  • Description

    Rabbit polyclonal to Cx37/GJA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Sheep, Rabbit, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Cx37/GJA4 aa 108-157 (internal sequence).
    Sequence:

    QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA


    Database link: NP_002051

  • Positive control

    • 721_B cell lysate.
  • General notes

    Previously labelled as Connexin 37 / GJA4.

Properties

Applications

Our Abpromise guarantee covers the use of ab83788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 37 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.

Target

  • Function

    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Tissue specificity

    Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.
  • Sequence similarities

    Belongs to the connexin family. Alpha-type (group II) subfamily.
  • Cellular localization

    Cell membrane. Cell junction > gap junction.
  • Information by UniProt
  • Database links

  • Alternative names

    • Connexin 37 antibody
    • Connexin-37 antibody
    • Cx37 antibody
    • CXA4_HUMAN antibody
    • Gap junction alpha 4 protein antibody
    • Gap junction alpha-4 protein antibody
    • gap junction protein, alpha 4 37kDa (connexin 37) antibody
    • gap junction protein, alpha 4, 37kD (connexin 37) antibody
    • Gap junction protein, alpha 4, 37kDa antibody
    • Gja4 antibody
    • OTTHUMP00000004181 antibody
    • OTTHUMP00000004182 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling Cx37 / GJA4
    with ab83788 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the membrane of alveolar type I cells and macrophages. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - Cx37 / GJA4. Right - Merge.

  • Anti-Cx37/GJA4 antibody (ab83788) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 37 kDa
    Observed band size: 37 kDa
    Additional bands at: 67 kDa, 85 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration: 12%
  • Western Blot using ab83788 at 1.0ug/ml. Sample type: Human Hela cell Lysate
  • Western Blot using ab83788 at 1.0ug/ml. Sample type: Human Jurkat cell Lysate
  • Western Blot using ab83788 at 1.0ug/ml. Sample type: Human MCF7 cell Lysate

References

ab83788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up