Overview

  • Product name

    Anti-CX3CL1 antibody [7F17]
    See all CX3CL1 primary antibodies
  • Description

    Rat monoclonal [7F17] to CX3CL1
  • Host species

    Rat
  • Tested applications

    Suitable for: Neutralising, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse CX3CL1 aa 25-336. Extracellular domain
    Sequence:

    QHLGMTKCEIMCDKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFC ADPKEKWVQDAMKHLDHQAAALTKNGGKFEKRVDNVTPGITLATRGLSPS ALTKPESATLEDLALELTTISQEARGTMGTSQEPPAAVTGSSLSTSEAQD AGLTAKPQSIGSFEAADISTTVWPSPAVYQSGSSSWAEEKATESPSTTAP SPQVSTTSPSTPEENVGSEGQPPWVQGQDLSPEKSLGSEEINPVHTDNFQ ERGPGNTVHPSVAPISSEETPSPELVASGSQAPKIEEPIHATADPQKLSV LITPVPDTQAAT


    Database link: O35188

Properties

Applications

Our Abpromise guarantee covers the use of ab194599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Neutralising Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 42 kDa.

Target

  • Function

    The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.
  • Tissue specificity

    Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the intercrine delta family.
  • Post-translational
    modifications

    A soluble short 95 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.
    O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A 152E5.2 antibody
    • AB030188 antibody
    • ABCD 3 antibody
    • ABCD3 antibody
    • AI848747 antibody
    • C-X3-C motif chemokine 1 antibody
    • C3Xkine antibody
    • Chemokine (C-X3-C motif) ligand 1 antibody
    • Chemokine C X3 C motif ligand 1 antibody
    • Chemokine CX3C Motif Ligand 1 antibody
    • CX3C membrane anchored chemokine antibody
    • CX3C membrane-anchored chemokine antibody
    • Cx3cl1 antibody
    • CXC 3 antibody
    • CXC3 antibody
    • CXC3C antibody
    • D8Bwg0439e antibody
    • FKN antibody
    • Fractalkine antibody
    • Neurotactin antibody
    • NTN antibody
    • NTT antibody
    • Processed fractalkine antibody
    • SCYD 1 antibody
    • SCYD1 antibody
    • Small inducible cytokine D1 antibody
    • Small inducible cytokine subfamily D (Cys X3 Cys) member 1 antibody
    • small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin) antibody
    • Small inducible cytokine subfamily D member 1 antibody
    • Small-inducible cytokine D1 antibody
    • X3CL1_HUMAN antibody
    see all

References

ab194599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up