Overview

  • Product name

  • Description

    Rabbit polyclonal to Cx50
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Cx50 aa 286-432.
    Sequence:

    MVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEG PPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEE PQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSKASSRARSDDLT


    Database link: P48165

  • Positive control

    • WB: HeLa and A549 whole cell lysates; Rat and mouse brain lysates. IHC-P: Human liver cancer and breast cancer tissues. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as GJA8.

Properties

Applications

Our Abpromise guarantee covers the use of ab222885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 48 kDa).

Target

  • Function

    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Tissue specificity

    Eye lens.
  • Involvement in disease

    Defects in GJA8 are the cause of cataract zonular pulverulent type 1 (CZP1) [MIM:116200]. A form of zonular cataract. Zonular or lamellar cataracts are opacities, broad or narrow, usually consisting of powdery white dots affecting only certain layers or zones between the cortex and nucleus of an otherwise clear lens. The opacity may be so dense as to render the entire central region of the lens completely opaque, or so translucent that vision is hardly if at all impeded. Zonular cataracts generally do not involve the embryonic nucleus, though sometimes they involve the fetal nucleus. Usually sharply separated from a clear cortex outside them, they may have projections from their outer edges known as riders or spokes.
    Defects in GJA8 are the cause of cataract-microcornea syndrome (CAMIS) [MIM:116150]. Cataract-microcornea syndrome is characterized by the association of congenital cataract and microcornea without any other systemic anomaly or dysmorphism. Clinical findings include a corneal diameter inferior to 10 mm in both meridians in an otherwise normal eye, and an inherited cataract, which is most often bilateral posterior polar with opacification in the lens periphery. The cataract progresses to form a total cataract after visual maturity has been achieved, requiring cataract extraction in the first to third decade of life. Microcornea-cataract syndrome can be associated with other rare ocular manifestations, including myopia, iris coloboma, sclerocornea and Peters anomaly. Transmission is in most cases autosomal dominant, but cases of autosomal recessive transmission have recently been described.
  • Sequence similarities

    Belongs to the connexin family. Alpha-type (group II) subfamily.
  • Cellular localization

    Cell membrane. Cell junction > gap junction.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAE antibody
    • CAE1 antibody
    • cataract, zonular pulverulent 1 (FY-linked) antibody
    • Connexin 50 antibody
    • Connexin-50 antibody
    • Cx50 antibody
    • CXA8_HUMAN antibody
    • Gap junction alpha 8 protein antibody
    • Gap junction alpha-8 protein antibody
    • Gap junction membrane channel protein alpha 8 (connexin 50) antibody
    • Gap junction protein alpha 8 antibody
    • gap junction protein, alpha 8, 50kD antibody
    • Gja8 antibody
    • Lens fiber protein MP70 antibody
    see all

Images

  • All lanes : Anti-Cx50 antibody (ab222885) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : Rat brain lysate
    Lane 4 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 48 kDa
    Observed band size: 49 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human liver cancer tissue stained for Cx50 using ab222885 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for Cx50 using ab222885 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Cx50 (green) using ab222885 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L).

References

This product has been referenced in:

  • Yu W  et al. Lens-specific conditional knockout of Msx2 in mice leads to ocular anterior segment dysgenesis via activation of a calcium signaling pathway. Lab Invest N/A:N/A (2019). Read more (PubMed: 30683901) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up