Overview

  • Product name

  • Description

    Rabbit polyclonal to CXCL11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse CXCL11 aa 22-98.
    Sequence:

    FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKR QRCLDPRSKQARLIMQAIEKKNFLRRQ


    Database link: Q9JHH5

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.
  • Tissue specificity

    High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • b R1 antibody
    • b-R1 antibody
    • Beta-R1 antibody
    • betaR1 antibody
    • C-X-C motif chemokine 11 antibody
    • Chemokine (C-X-C motif) ligand 11 antibody
    • Chemokine C-X-C motif ligand 11 antibody
    • CXC11 antibody
    • CXCL11 antibody
    • CXL11_HUMAN antibody
    • H174 antibody
    • I TAC antibody
    • I-TAC antibody
    • Interferon gamma inducible protein 9 antibody
    • Interferon gamma-inducible protein 9 antibody
    • Interferon inducible T cell alpha chemoattractant antibody
    • Interferon-inducible T-cell a chemoattractant I-TAC antibody
    • Interferon-inducible T-cell alpha chemoattractant antibody
    • IP 9 antibody
    • IP-9 antibody
    • IP9 antibody
    • ITAC antibody
    • MGC102770 antibody
    • SCYB11 antibody
    • SCYB9B antibody
    • Small inducible cytokine B11 antibody
    • Small inducible cytokine subfamily B (Cys-X-Cys) member 11 antibody
    • Small inducible cytokine subfamily B (Cys-X-Cys) member 9B antibody
    • Small inducible cytokine subfamily B, member 11 antibody
    • Small inducible cytokine subfamily B, member 9B antibody
    • Small-inducible cytokine B11 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for CXCL11 with ab235977 at 1/100 dilution in immunohistochemical analysis.

References

ab235977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up