Overview

  • Product name

  • Description

    Rabbit polyclonal to CXCL7/PBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse CXCL7/PBP aa 40-113. (Expressed in E.coli).
    Sequence:

    KSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKN GQKTCLDPNAPGVKRIVMKILEGY


    Database link: Q9EQI5

  • Positive control

    • IHC-P: Mouse testis, lung and spleen tissues. WB: Mouse spleen and lung lysates; Mouse serum; Recombinant mouse CXCL7/PBP protein.
  • General notes

    Previously labelled as CXCL7. 

Properties

Applications

Our Abpromise guarantee covers the use of ab231102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 12 kDa.

Target

  • Function

    LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    Proteolytic removal of residues 1-9 produces the active peptide connective tissue-activating peptide III (CTAP-III) (low-affinity platelet factor IV (LA-PF4)).
    Proteolytic removal of residues 1-13 produces the active peptide beta-thromboglobulin, which is released from platelets along with platelet factor 4 and platelet-derived growth factor.
    NAP-2(1-66) is produced by proteolytical processing, probably after secretion by leukocytes other than neutrophils.
    NAP-2(73) and NAP-2(74) seem not be produced by proteolytical processing of secreted precursors but are released in an active form from platelets.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • B TG1 antibody
    • Beta TG antibody
    • Beta thromboglobulin antibody
    • Beta-TG antibody
    • C-X-C motif chemokine 7 antibody
    • Chemokine (C X C motif) ligand 7 antibody
    • Connective tissue activating peptide III antibody
    • CTAP 3 antibody
    • CTAP III antibody
    • CTAP-III antibody
    • CTAP-III(1-81) antibody
    • CTAP3 antibody
    • CTAPIII antibody
    • CXC chemokine ligand 7 antibody
    • CXCL 7 antibody
    • CXCL7 antibody
    • CXCL7_HUMAN antibody
    • LA PF 4 antibody
    • LA-PF4 antibody
    • LDGF antibody
    • Leukocyte derived growth factor antibody
    • Leukocyte-derived growth factor antibody
    • Low-affinity platelet factor IV antibody
    • Macrophage-derived growth factor antibody
    • MDGF antibody
    • NAP 2 antibody
    • NAP-2 antibody
    • NAP-2(1-63) antibody
    • NAP-2(1-66) antibody
    • NAP-2(73) antibody
    • NAP-2(74) antibody
    • Neutrophil activating peptide 2 antibody
    • Neutrophil-activating peptide 2(1-63) antibody
    • PBP antibody
    • Platelet basic protein antibody
    • PPBP antibody
    • Pro platelet basic protein (chemokine (C-X-C motif) ligand 7) antibody
    • Pro platelet basic protein antibody
    • SCYB7 antibody
    • Small inducible cytokine subfamily B member 7 antibody
    • Small-inducible cytokine B7 antibody
    • TC1 antibody
    • TC2 antibody
    • TGB antibody
    • TGB1 antibody
    • THBGB antibody
    • THBGB1 antibody
    • Thrombocidin 1 antibody
    • Thrombocidin 2 antibody
    • Thromboglobulin, beta-1 antibody
    see all

Images

  • Anti-CXCL7/PBP antibody (ab231102) at 2 µg/ml + Mouse lung lysate

    Predicted band size: 12 kDa

  • Anti-CXCL7/PBP antibody (ab231102) at 3 µg/ml + Mouse serum

    Predicted band size: 12 kDa

  • Anti-CXCL7/PBP antibody (ab231102) at 2 µg/ml + Mouse spleen lysate

    Predicted band size: 12 kDa

  • Anti-CXCL7/PBP antibody (ab231102) at 2 µg/ml + Recombinant mouse CXCL7/PBP protein

    Predicted band size: 12 kDa

  • Formalin-fixed, paraffin-embedded mouse lung tissue stained for CXCL7/PBP using ab231102 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse spleen tissue stained for CXCL7/PBP using ab231102 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for CXCL7/PBP using ab231102 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab231102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up